General Information

  • ID:  hor004561
  • Uniprot ID:  C0HKV8
  • Protein name:  Neuropeptide SIFamide
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in antennal lobe (AL) and gnathal ganglion (GNG) with expression detected in most animals (at protein level). Not expressed in corpora cardiaca (CC) and corpora allata (CA) (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TYRKPPFNGSIF
  • Length:  12(23-34)
  • Propeptide:  MRFIVALCLFAIVMCIIHKAEGTYRKPPFNGSIFGKRGVVEYDTTGRALSALCEIASETCQAWYQTLENK
  • Signal peptide:  MRFIVALCLFAIVMCIIHKAEG
  • Modification:  T12 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Ligand for the neuropeptide SIFamide receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HKV8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004561_AF2.pdbhor004561_ESM.pdb

Physical Information

Mass: 162300 Formula: C68H99N17O17
Absent amino acids: ACDEHLMQVW Common amino acids: FP
pI: 10.45 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -68.33 Boman Index: -2140
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 836.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  29466015
  • Title:  Mating-induced differential peptidomics of neuropeptides and protein hormones in Agrotis ipsilon moths.